PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000153949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 615aa    MW: 68257.3 Da    PI: 8.3443
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000153949genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.71.3e-5451311129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yL++kv++ +++  +++++vd++k+ePwdLp k++ +ekewyfF  rd+ky+tg r+nrat++gyWk+tgkdke+++ +
  MDP0000153949   5 LPPGFRFHPTDEELITHYLCHKVSDVSFTS-KAVADVDLNKCEPWDLPGKASMGEKEWYFFNLRDRKYPTGLRTNRATEAGYWKTTGKDKEIHR-T 98 
                    79*************************999.88***************988999***************************************9.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                    g lvg+kktLvfykgrap+gek++Wvmheyrle
  MDP0000153949  99 GVLVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                    9******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-633151IPR003441NAC domain
PROSITE profilePS5100559.6935151IPR003441NAC domain
PfamPF023655.3E-286130IPR003441NAC domain
PfamPF143045.4E-6585614IPR026896Transcription termination and cleavage factor, C-terminal domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031124Biological ProcessmRNA 3'-end processing
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MQESLPPGFR FHPTDEELIT HYLCHKVSDV SFTSKAVADV DLNKCEPWDL PGKASMGEKE  60
WYFFNLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIHRTGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFKSSK EEWVVCRVFQ KSISALKKPQ QATTSSHQQP SIESPCDDTN  180
SIVNEFGDIE LPNLNSNINA NSSSGFSNNI SSPPSYYSNI IDHSKNNIND VTNMSLNMNW  240
AATAAREAAV NAVSWPSSLL SPSNLSVNSL LLRALHLRSS TNNNGSNYQP RDTNHGQATA  300
GTSTLDYSSY NTMQQQGMMP SISHHIGSST TMDHINSNFQ ASSSSIKDQM MESMPPQQHS  360
EQPFNLDSIC IQPPTSHNSQ QSTQPTQQPS TQAAPSLPGQ VGLQDQTGPS QVQAPPRKQY  420
QNQPAMPSSS AGAPSINVQS QPMPSRPLQN PQQPKGHLNP QMNPTFLPQS SQLPNMPAHP  480
LHSSSQLPSL HQTQMSSASG QLQRHYRHLE FLICRCNHHC LHNQDHLKCL TSITKFNNQA  540
GSSMQVDRGS WMSGPPESST VPLPGGGQPP HPPPLSPEME KVLHQQVMTL TPEQINLLPP  600
EQKSPVLLLQ KILRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-56215717174NAC domain-containing protein 19
3swm_B3e-56215717174NAC domain-containing protein 19
3swm_C3e-56215717174NAC domain-containing protein 19
3swm_D3e-56215717174NAC domain-containing protein 19
3swp_A3e-56215717174NAC domain-containing protein 19
3swp_B3e-56215717174NAC domain-containing protein 19
3swp_C3e-56215717174NAC domain-containing protein 19
3swp_D3e-56215717174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.38131e-179bud| fruit| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356654.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
RefseqXP_008374753.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLM5WUQ11e-157M5WUQ1_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-105NAC domain containing protein 58